SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006099092.2.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006099092.2.53796
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-31
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 173-273
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-25
Family SH2 domain 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006099092.2.53796
Sequence length 378
Comment PREDICTED: SH2B adapter protein 3, partial [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
REPPPEVLKEAVLRYSLADEASMDSGARWQRGRLALRARGPGGVDRVLELFDPPKSSKPK
LQAACSSLQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELRKCTGQG
LESTDPELHVPSAPEPGTASSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFHGPI
SRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHL
HFPSVMDMLHHFQRSPIPLECGSACDVRLSSYVVVVSQPPGSSNTVLFPFSLSRWDSELG
LPHLSSSGCPRGLGPEGLPGRSSPQEQIFHLVPSPEELANSLRHLESEPANRARDSDYEM
DSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences G1PSL1
XP_006099092.2.53796 ENSMLUP00000014165 ENSMLUP00000014165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]