SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006100827.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006100827.1.53796
Domain Number 1 Region: 182-259
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-20
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000209
Family LASP-1 0.003
Further Details:      
 
Weak hits

Sequence:  XP_006100827.1.53796
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000279
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006100827.1.53796
Sequence length 260
Comment PREDICTED: LIM and SH3 domain protein 1 isoform X1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MNPNCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDSTSYRRPQEQQPHHIPTGTPVYQQPQQQQVAP
SYGGYKEPAAPVSTQRSAPSGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMY
GTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences G1PGV9
ENSMLUP00000009890 ENSMLUP00000009890 XP_006100827.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]