SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006102291.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006102291.1.53796
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.03e-38
Family CAD domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006102291.1.53796
Sequence length 219
Comment PREDICTED: cell death activator CIDE-B [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MEYLSALKPSSLVRSVSNMSSEFGRRVWTSPPPPQRPFRVCDHKRTVRKGLTAATRQELL
DKALETLLLSGVLTLVLEEDGTAVESEDFFQLLEDDTCLMVLESGQSWSSSRSGMLSYGL
GREKPKHSKDIARITFDVYKQNPRDLFGSLNVKATFYGLYSMSCDIQGLGPKKILREFLR
WTSTLLQGLGHMLLGISSTLRHVVEGATQWQQQGHLHPY
Download sequence
Identical sequences G1PQU9
ENSMLUP00000013478 XP_006102291.1.53796 ENSMLUP00000013478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]