SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006103493.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006103493.1.53796
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-61
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 2 Region: 552-622
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.73e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 484-549
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 267-346
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006103493.1.53796
Sequence length 1202
Comment PREDICTED: caskin-2 isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGILAPRLPSAP
TPLRPNFSRTPQPPADDSLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSAGEDQGLPGLHPPSLAGSLSHRPLANCHSGEQLFTQDV
RPEQLLEGKDAQAIYNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSITEWLPNYIPADLLEWLCALGLPQYHKKLLSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLHGEATGEGGRRLARGPELMAIEGLENGDGPAAA
GPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQPS
SGDPSTPQERNLPEGTERPPKLCSPLPGQGPPGYVFMYPQGSPSSPAPGPPPGAPRAFSY
LAGPPAAPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPVGSALGSYATLTRRPGRSTLAR
PSPSQTPVRGAPRSQSFALRARRKGPPPPPPKRLSSVPGPTPEPPSLDGSLGPKEGAPGP
RRRTLSEPAGPSEPPGPPAPAGPASDTEEEEDPGPEGTPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPPSRETPVPTGLDFNLTESDTVKRRPKCREREPLQTALLAFGVATTMPSPSVP
MTSQTPSESPVASPCPPQPDPSSLPTQGAPAPLPPSPPTQPSKPPCPGPALENSAGNRQR
GEPEPPAPPAALIKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGAVG
SGQAQQRLERTSSSLAAALRAAEKSIGAEEREGPPSTSTKHILDDISTMFDALADQLDAM
LD
Download sequence
Identical sequences G1PRZ8
XP_006103492.1.53796 XP_006103493.1.53796 ENSMLUP00000013929 ENSMLUP00000013929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]