SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006104942.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006104942.1.53796
Domain Number 1 Region: 25-141,191-276
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.73e-18
Family DNA gyrase/MutL, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006104942.1.53796
Sequence length 1032
Comment PREDICTED: MORC family CW-type zinc finger protein 2 isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRMDIYAERREDLRG
GFMLCFLDDGAGMDPNDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTK
KDDTMTCLFLSRTFHEEEGIDEVIVPLPTWNARTRDPLTDNLEKFSIETELIYKYSPFHN
EEEVMTQFMKIPGDSGTLVIIFNLKLMDNGEPELDIVSNPRDIQMAETSPEGTKPERRSF
RAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSSRFKTRAEQEVKKAEHVAR
IAEDKAREAESKARALELRLGGDLTRDSRVMLRQVQNTAITMRREADVKKRIKDAKQRAL
KEPKELNFIFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLV
LEPTHNKQDFADAKEYRHLLRAMGDHLAQYWKDIAIAQRGIVKFWDEYGYLSANWNHPPS
SDVRYKRRRSMEIPTTIQCDLCLKWRTLPFQLHSVEKEYPDTWVCSMNPDPEQDRCEASE
QKQKVPLGTLKKDLKTPEEKQKQLTEKIRQQQEKLEAMQKTTPIRSQADLKKLPLEVTTR
PSSEEPARRPQRPRSPPLPAVIKNAPSRPPALHTPRPTRKAPAISSTPKPPALAAREEAC
TSRLLQPPEAPRKPANTAVKTVPRPTPPVQPLSPSLLPNSKSPRDVPTPRAVKMPVVKKP
EPPSKPPPATPGRKRALDASDEEEAEEEAERRKERPKRGKITVKEEKKDLSELSDSAEED
SADLKKAQKDKGLHVEVRVNKEWYTGRVTAVEAGKHAVRWKVKFDYVPTDTTPRDRWVEK
DSEDVRLMKPPSPEYQSPDTQQGGGEEESTKAPLVEAQPAVAVTDPSTSDCTRIEPDTTA
PSSNHETIDLLVQILRNCLRYFLPPSFPISKKELSAMNSDELISFPLKEYFRQYEVGLQN
LCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDEL
DAYIEDLITKGD
Download sequence
Identical sequences G1P8D8
ENSMLUP00000006433 XP_006104942.1.53796 ENSMLUP00000006433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]