SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006105574.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006105574.1.53796
Domain Number 1 Region: 45-121
Classification Level Classification E-value
Superfamily HMG-box 4.32e-29
Family HMG-box 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006105574.1.53796
Sequence length 232
Comment PREDICTED: protein SOX-15 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MALPGLSQDRAWSLEPPTPTAPASSPSGSQEREDAESPVVSGGLPLEKVKRPMNAFMVWS
SAQRRQMAQQNPKMHNSEISKRLGAQWKLLGEDEKRPFVEEAKRLRARHLRDYPDYKYRP
RRKTKSAGAGLPHFGQGSGGVAVSGPVWGPGYVTTQGSRGFGYQPPNYSTSYLPRGFSSS
HSKPEASTCSLHQSNPRLQGELLPHYNPYPPPGSPTPYNPPLSGAPMPLAHL
Download sequence
Identical sequences G1P054
ENSMLUP00000003122 XP_006105574.1.53796 ENSMLUP00000003122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]