SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006107043.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006107043.1.53796
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.05e-35
Family Small-conductance potassium channel 0.00000523
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006107043.1.53796
Sequence length 541
Comment PREDICTED: small conductance calcium-activated potassium channel protein 1 isoform X2 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MNNHSHNGCGGRPLGGGLGALTRDPPDAEASCPLQPPHSSGLQVVVAKNELGGLSPGSPR
GQPQDQEEEEDDEEDEVVGQRGSKRPPNVGHRLGHRRVLFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTVILLGLVILYHAREIQLFMVDNGADDWRIA
MTCERVLLISLELAVCAIHPVPGHYRFTWTARLAFTYAPAAAEADVDVLLSVPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDYARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLAELAKTQNAMYDLMSELHAQHEDLEA
RLAALESRLDALGTSLQALPSLITQAIHPLPPPLPPQPGAPDQAAQSSPCRWPPVAPSDC
G
Download sequence
Identical sequences G1PAD2
ENSMLUP00000007238 ENSMLUP00000007238 XP_006107043.1.53796 XP_006107046.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]