SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006115060.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006115060.1.96668
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-45
Family Third domain of FERM 0.000000226
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 8.11e-38
Family Second domain of FERM 0.00000104
Further Details:      
 
Domain Number 3 Region: 499-587
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-32
Family Moesin tail domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006115060.1.96668
Sequence length 587
Comment PREDICTED: ezrin [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MPKPLNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYTDNKGFLTWLK
LDKKVSAQEVKKENPLQFKFRAKFFPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEAHKPGYLNSERLIPQRVMDQHKLSREQWEERIEVWHAEHG
GMLKENAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERQQLENEKKKRETIEREKEQMLREKEELMVRLQEYEIKTRK
AEKELSDQVQKALQLEEERRRAEKEAERLETERLAALQAKEELEKQTVDQMKSQEQLAAE
LAEYTAKIALLEEARKRKENEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPAPVYE
PVNYHVHDNLHDEGTEYSGYSAEFSSEGILGDRNEEKRITEAEKNQRVQRQLMTLTDELA
QARDENKKTHNDMIHTENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences K7GJ00
XP_006115060.1.96668 ENSPSIP00000020261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]