SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006124180.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006124180.1.96668
Domain Number 1 Region: 282-402
Classification Level Classification E-value
Superfamily TIMP-like 9.58e-36
Family Netrin-like domain (NTR/C345C module) 0.0003
Further Details:      
 
Domain Number 2 Region: 21-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-34
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 3 Region: 142-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006124180.1.96668
Sequence length 402
Comment PREDICTED: procollagen C-endopeptidase enhancer 2 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MFQKEMLMLVFLEEDRPAFTCGGSLSGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVV
LSFRYIDLESDNLCRYDFVDVYNGHANGQRLGRFCGTFKPGALVANGNKMLVQMISDANT
AGNGFIAMFSAAEPHERGDQYCGGRLDKPSGSFKTPNWPDRDYPAGVTCSWHIVAPRNQV
IELKFEKFDVERDNYCRYDFVAVFNGGEINDAKRIGKYCGDSPPAPIVSERNELLVQFLS
DLSLTADGFIGHYKFRAKKLPTTTAPATTTPFATATLKPTVALCQQKCGRNGTPESNYCS
SNFVITGTVITAVTRGGSLHATISIINVYKEGNLAIQQAGKNMSTKIIVVCKQCPLIRRG
LNYIIMGQLEEDGRGKILPNNFVMSFKTKNQKTLNTLKNKRC
Download sequence
Identical sequences XP_006124180.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]