SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006133997.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006133997.1.96668
Domain Number 1 Region: 106-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 253-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 69-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000135
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006133997.1.96668
Sequence length 455
Comment PREDICTED: sushi repeat-containing protein SRPX isoform X1 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MGSRSLRVALLLLTWGVCLSLAYQGSGYSPTEDDEDVYARNRYKDTPWCSPIKVKHGNAN
CRTPQGEYYKNVLGTRCDIRCQKGYELHGPQQLICQSNKRWSGKVLCKQIRCPTLAMPIN
GGFKCIDGAYFNSRCEYYCSPGYQLKGERTVTCMDNKVWSGRPASCVDTEPPRIQCPSVK
EKMAEPNKLTARVFWETPEGRDTADGILTDVILKGLPPGSHFPEGDHKIQYTVYDRAENK
GTCKFLVKVKVRRCGKLNAPENGYIKCTGDGDNYGATCEFSCIGGYELQGSPARVCQYNL
GWSGTEPTCTPMNINVAVRTAAALLDQFYEKRRLLIVSTPTAANFFYRLQLGMLQPEQCG
LDLRHVTVIELVGVFPAQIGRIGVKLLPPALALQLRLLLRIPHYNFNVVVMDKHGMDKER
YLFPATAAQLFALIDSFPLRKEEMKLQAETGQLCT
Download sequence
Identical sequences K7FVG6
ENSPSIP00000012026 ENSPSIP00000012026 XP_006133997.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]