SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006135457.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006135457.1.96668
Domain Number 1 Region: 80-94,229-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-67
Family Nuclear receptor ligand-binding domain 0.00000000363
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006135457.1.96668
Sequence length 469
Comment PREDICTED: nuclear receptor subfamily 5 group A member 2 isoform X2 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDK
TQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLK
LEAMTQVIQAMPTDLTISSAIQNIHSASKGLPLNHTALPPTDYDRSPFVTSPISMTMPPH
GSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCE
PDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVD
DQMKLLQNCWSELLILDHIYRQVVHGKEGSILLVTGQQVDYSVIASQAGATLNNLMSHAQ
ELVAKLRSLQFDLREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQ
TDKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPCNNLLIEMLHAKRA
Download sequence
Identical sequences K7F721
ENSPSIP00000003831 XP_005423765.1.5688 XP_005487137.1.73095 XP_006135457.1.96668 XP_009281449.1.47732 XP_009324441.1.49731 XP_009472690.1.38621 XP_009485812.1.14425 XP_009634488.1.23211 XP_009933153.1.35112 XP_009947280.1.99599 XP_010170805.1.30499 XP_013046117.1.65836 XP_013816721.1.3284 ENSPSIP00000003831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]