SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006137906.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006137906.1.96668
Domain Number 1 Region: 439-603
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000483
Further Details:      
 
Domain Number 2 Region: 617-740
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family PDZ domain 0.0000319
Further Details:      
 
Domain Number 3 Region: 732-816
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-16
Family PDZ domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006137906.1.96668
Sequence length 823
Comment PREDICTED: amyloid beta A4 precursor protein-binding family A member 1 isoform X1 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MNHLEGPPQGEVNDEPANGEVNESVEADLEHSEVEEEQQQYATHYPRHASGSQGQSGQEE
EGMLARSASTESGFHNHTDTAEGDVIATAEYGYDTDRVQENEDESAYAVQYRPESEEYTE
NAEAEHAEATHARTLPNHLHFHSIEHEEAMNAAYSGYVYTHGLFHRGEDEQYAEPYADYG
LQEHVYEEIGDAPDLDVREGLRLYEQEREEADNYRKEALGARLHHYDERSDGESDSPEKE
AEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKLAEDMPEAEQNLECAHTPSRGTLE
SNGQLPTGSRPTANSGESVQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKE
PIWVMRQDISPTRDCDDQRPLDGDSPSPDSSSPRGAESSSRQHHQDVCGTAEPSTNKESR
KSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIK
MAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNI
VVLMARRRMPRSNSQDNVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQE
FLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVYIEKQKGEILGVVIVES
GWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQAR
VKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQ
SVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences K7FVX2
ENSPSIP00000012182 ENSPSIP00000012182 XP_006137906.1.96668 XP_014436472.1.96668 XP_014436473.1.96668 XP_014436474.1.96668 XP_014436475.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]