SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006139076.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006139076.1.96668
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-37
Family Second domain of FERM 0.00000284
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-27
Family First domain of FERM 0.0000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006139076.1.96668
Sequence length 881
Comment PREDICTED: band 4.1-like protein 3 isoform X22 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MTTESGSDSESKDQDQDQQEAPAQQGTAGTQPQDQQQLSEEHQNAIDQFSAVAAHSTPVK
KEQVTEREQEFAAAAAKQLEYQQFEEDKLSQKSSCSKLSRSPLKIVKKPKNMQCKVTLLD
GSEYGCEVEKRSRGQILFDKVCEHLNLLEKDYFGLTYRDMENQKNWLDPAKEIKKQIRSG
AWQFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDEYGGDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEMYMKDSMSAAEVGTGQYATTKGIS
QTNLITTVTPEKKPEEERDEEEGKKKGEEITPVSAIRHDTKELDKNQEDLMKHQTNISEL
KRTFLETSTDTAVTNEWEKRLSTSPVRLATRHEEAPMIEPLVPEETKEEKEKSEKLIFLQ
KGSSTFLESQRTEATTGQQISAREMKQEIQSHQDAAKKVVQETVLVEERYMTNVHASGDA
VKLAGNLLDAMAQAVSAEASSITGKEGSAVTEGDKEKKREEADKAVAKQEEIAAASHLQE
EEQSATVHVSDTLERKPHFEQSPILKTETISFDSVSPGGEKLEISSKEVPVVHTETKTIT
YESSQTDSGADSEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDAD
IDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences K7FCH4
ENSPSIP00000005734 XP_006139076.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]