SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006161044.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006161044.1.99106
Domain Number 1 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.51e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-18
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 
Domain Number 10 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 83-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000278
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 12 Region: 278-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000115
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006161044.1.99106
Sequence length 642
Comment PREDICTED: zinc finger protein 709 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MDSVVFEDVAVNFTQEEWVLLAPSQKKLYRDVMRETFINLASVEKKWEDQNSEDPYANQG
RNLRNHVVQKPCETKQSNQFEETFSQTPNLKSNRKTFTGRKPYECVVCEKVYVCHSSLKR
HMRSHTEPKLYGYNKYGEKSYECKECGKTFSFRSSFRIHERTHTGEKPYKCKQCGKAFSW
PSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSF
RNHERTHSGEKPYECKQCGKAFTYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHE
RIHTGEKPYKCRKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSFRRHMIMHT
GNGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKP
HECKQCGKAFSCSSSVRIHQRTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECK
QCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGK
AFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHSGEKPYECKQCDKAFSC
SRSFRIHERTHTGEKPYKCKQCGKAFKCSRSFRIHVKTHTGE
Download sequence
Identical sequences XP_006161044.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]