SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006167847.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006167847.1.99106
Domain Number 1 Region: 528-747
Classification Level Classification E-value
Superfamily Bet v1-like 3.23e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 89-247
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006167847.1.99106
Sequence length 756
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X2 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MQQCGVPIPPSPLSTPTFLPVVTREGRSLASRGLSLSGGAGRSAGVTATAADGWKGRLPS
PLVLLPRSSRCQARRRRRRNGRTSSLLLHPPAPERALLASPSSDPSPRGLGTSSGSAQGG
AGAGLLLGCRVSMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLK
NNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQW
IDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFR
DILCRQVDTLQKFFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLF
PHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRAE
EGYKNAMIELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLH
WPTSLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYS
LQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR
NDWETTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPAKTENDPETWIV
CNFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNHEISRDNILCKITYVANVNPGGW
APASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_006167847.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]