SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006168076.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006168076.1.99106
Domain Number 1 Region: 127-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-27
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 2 Region: 334-449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000837
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 294-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 538-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 499-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006168076.1.99106
Sequence length 845
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 3 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MAVTLFYMACLCDPSLSSAPCRETRLLKASLAQPVSHEMHKPQADVECGLKACRGGGTLV
TAAKVDSASSGWHPLVDSSPDGDPKPEKQALGPVRMTGAGAQLAVVCLVNIFLTGRLSSA
VPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEES
HQCSLDWLVLGPAAPPRQEAFRLCGSAIPPAFISARDHGWIFFHSDASSSGQAQGFRLSY
IRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGT
FPCSGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARG
PSDLHCTWLVDTQDPRRVLLQQELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSL
EAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGDGGSAGDQGCFSEPQ
RCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYSPADRCNNQKSCPDGADEKNCFSCQ
PGTFHCGTNLCIFETWRCDGQEDCQDGXCRPAAPRKFITAALIGSLVCGLLLVIALGCAF
KLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQ
NLRRQMPRAPSRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAG
TTPDPPAPLTDTDSPRDAGDGPPSAPGQASEVGPSVPPMPSGLRDPECRPMDKDRKAIRD
PQVDSPAPADTPREPCLAQAPYPQAPTASSTLGPHSPEPPGACRSPLPPCSPALEASDDE
ALLVC
Download sequence
Identical sequences XP_006168076.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]