SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006172097.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006172097.1.99106
Domain Number 1 Region: 130-330
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.29e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 15-104
Classification Level Classification E-value
Superfamily WWE domain 2.22e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006172097.1.99106
Sequence length 331
Comment PREDICTED: poly [ADP-ribose] polymerase 11 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MFHKAEEFLFKTTESEMDDMDTSETQWGWFYLAECGKWHMFQPDTNIQCSVSSEDIEKSF
KTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPP
HWENVNTEVPYQLIPLHNQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQ
LKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKGTYFARDAAYSSRF
CKDDMKHGNTFQIHGVSLQQRHLFRTHKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNL
YDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences ENSTBEP00000008471 ENSTBEP00000008471 XP_006172097.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]