SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006196454.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006196454.1.17985
Domain Number 1 Region: 2206-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 1.04e-32
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-29
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 3 Region: 1470-1518,1596-1710
Classification Level Classification E-value
Superfamily FAS1 domain 5.1e-28
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1712-1865
Classification Level Classification E-value
Superfamily FAS1 domain 8.89e-25
Family FAS1 domain 0.0057
Further Details:      
 
Domain Number 5 Region: 962-1119
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-22
Family FAS1 domain 0.0038
Further Details:      
 
Domain Number 6 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 1.12e-17
Family FAS1 domain 0.0072
Further Details:      
 
Domain Number 7 Region: 386-496
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000000366
Family FAS1 domain 0.012
Further Details:      
 
Domain Number 8 Region: 1128-1251
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000209
Family FAS1 domain 0.0064
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006196454.1.17985
Sequence length 2569
Comment PREDICTED: stabilin-1 isoform X2 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MVVPRGCLLLCLLALCLAGSSFITGQKVQSRHCDVKTKFVTHVPCTPCSAIKKRMCPLGW
LRESPEKIPQDCRYEVQLGDSLVSMSGCSLECWQDVVQKACCPGYWGSQCYECPGGADTP
CNGHGTCLDGIDRNGTCVCQENFSGSACQECSDPNRFGPDCQSVCSCVHGMCRHGPLGDG
SCLCFAGYTGPQCDQELPICQALNCPQNSQCSVEAPTCSCLPGYTQQGSECRAPDPCQPS
PCSPLAQCSVSPQGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPGNSTLCLYKKPGQAS
CTCKPGLVSINHNPSAGCFAYCYPYSCDRSATCQVTPDGRTSCVCKEGQVGDGRACYGHL
LHEMQKASQMGLTFTRLRVTLAMMDQGCRDILTTSGPFTVLVASGISRTMNASVAQQLCR
QYIIAGQHMLEESGTQPTRRWWTLAGQEITVTFNIFRKYTYKYKDQPQQTFTVHKANYPA
ANGVFHMVSALQGRPPLELPGDPKRTIGQILASTEVFTRFETILENCGLPSFLDGPGPFT
VFAPSNEAVDSLRDGRLIYLFTMGLSKLQELVRYHIHSHSQLTIEKLISKGRVLTMANQV
LAVNISEEGRILLGPDGVPLRRVDIQAANGVIHMLEGILLPPTILPILPKLCNEEQHRVV
VGSCVDCQALNSSMCPPNSVKLDMSPEECIYTHDPIGLNVLKKGCAHYCNQTILKPGCCK
GFFGPDCAQCPGGFSNPCYGKGNCSDGVQGNGACLCFPDYKGIACHICSNPKKHGDQCQE
DCGCVHGLCDNRPGSMGVCQRGTCAPGFSGRFCNESMGSCGPTEQSQLCHLHARCVNQGG
VARCLCLDGFEGDGFSCTPSNPCSRPDRGGCSENADCVPGAPGTNHCTCHKGWSGDGRVC
VAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLA
TCRAVGGGQRVCTCPPGYGGDGFSCYGDIFQELEANAHFSVFYQWIKGAGITLPADSRVT
ALVPSESAIRRLSREDQAFWLQPRMLPQLVRAHFLQAALSEEELARLDGQSVATLSPTTR
WEIHNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPREDALSGQGLLQQLDSVPAFH
LFRELLQRHKLVPQIEAATAYTIFVPTNRSLEAQANSSSLDVDVVRHHVILGEALSMEAL
RRGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLGAPGRSLFGLSGVLTVGSSRCLH
SHAEALREKCVNCSRKFRCTQGYQLEDTPKKSCVYRSGYSFSRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGANCTGV
CDCAHGLCQEGLRGDGTCVCNAGWHGLRCDQKITGPQCPQKCDPNANCIRDSAAAPACVC
AAGYSGNGISCSEVDPCAHDRGGCSPHANCTKVAPGQRICTCLDGYTGDGELCQEVNGCL
IHHGGCHMHADCIPTGPQQVSCSCREGYSGDGIRTCELLDPCSQNNGGCSPYAVCKSTGD
GQRTCTCNAAHTVGDGFTCRARVGLELLRDKHASFFSLHLLEYKELKGEGPFTIFVPHAD
LMANLSQDELARIRANRQLVFRYHVVGCRQLRSQELLEAGYATTLSGHTLRFNEREGSVY
INDFARVVSSDHEAVNGVLHFLDRVLLPPEALHWEPDMAPTPRRNITAAAESFGYKIFSG
LVTMAGLLPLLRDSSHRPLTMLWPTDSALRALPPDRQVWLYHEDHREKLAAILRGHVIRN
IEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEEDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDRFETRPLWLKICSICGLEPPCPEGSQEQGSPEACWRYFSKFWTSPPLH
SLALRSVWARPSHWGQPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCSDH
GVCMDGMSGSGYCRCRPGFAGTACELCAPGAFGPLCQACSCTSHGHCDEGTGGSGSCFCD
EGWTGPRCEVQLELQPVCAPPCAPQAVCRMGNSCECSLGYEGDGYTCTVVNLCQDGRGGC
SEHANCSQVGTRVACTCLPDYEGDGWSCRARNPCEDGHRGGCSEHADCLNTGPNTRRCVC
HAGYVGDGLHCLEEPEPPVDRCLDQPPPCHVDAVCTDLHFQEKRAGVFHLQATSGPYSLN
FSEAEAACRAQGADLASLPQLSAAQQLGLHLCLVGWLANGSAAHPVVFPAADCGDGQVGV
VSLGARKNLSERWDAYCYRVQDVACRCRDGFVGDGTSVCNGKLLDVLATTANFSTFYGML
LEYANATQRGLDFLDFLNDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTFLSTNAS
QGTLLPAHSGLSLVISNVGPDNSSWAPVVPGAVAVSRVITWDIVAFNGIIHALASPLLAP
PQPRAVVAPEAPPVAAGVGAVVAAGALLGLVAGALYLRARGRATGFGFSAFQVEDDAADD
FSPWQKGTSPTLVSVPNPVFGSPDAFCEPFDDSLLEEDYPDTQRILAVK
Download sequence
Identical sequences XP_006196454.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]