SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006198839.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006198839.1.17985
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.29e-196
Family Myeloperoxidase-like 0.00000000000000957
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006198839.1.17985
Sequence length 604
Comment PREDICTED: prostaglandin G/H synthase 2 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MLARALLLCAALAFCGAANPCCSNPCQNRGVCMSIGFDQYKCDCTRTGFYGENCSTPEFL
TKIKLLLKPTPNTVHYILTHFKGIWNIVNNISFLRNMIMKYVLISRSNLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGRKELPDSKEVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLNHGVDLNHVYGESLERQHKLRLFKDGKMKY
QVIGGEVYPPTVKDTQVEMIYPPHVPEHLQFAVGQELFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFQIGDQEYNYQQFIYNNSILLEHGVTQFVESFSRQIAGRV
AGGRNLPAAVQTVAKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDVMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
Download sequence
Identical sequences XP_006198839.1.17985 ENSVPAP00000005398 ENSVPAP00000005398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]