SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006202638.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006202638.1.17985
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 3.32e-42
Family Calmodulin-like 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006202638.1.17985
Sequence length 172
Comment PREDICTED: myosin regulatory light polypeptide 9 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
MGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A226MQ06 A0A2K6EI70 F7BYZ9 G3URE9 P02612 Q1LZF9 S9WRY3
9031.ENSGALP00000034131 9796.ENSECAP00000005628 ENSGALP00000041913 ENSECAP00000005628 ENSBTAP00000015248 ENSECAP00000005628 NP_001068702.1.59421 NP_001068702.1.76553 NP_990609.1.86415 XP_001502062.1.31192 XP_004370434.1.4749 XP_004467125.1.11602 XP_004467126.1.11602 XP_005896079.1.15283 XP_005968113.1.78601 XP_006072524.1.26621 XP_006188666.1.101512 XP_006202638.1.17985 XP_007932822.1.48129 XP_008528455.1.77740 XP_008566536.1.73410 XP_010720520.1.16129 XP_010827519.1.44457 XP_010959079.1.22495 XP_010973502.1.51371 XP_011970195.1.54773 XP_011970493.1.54773 XP_012493158.1.63892 XP_013051393.1.65836 XP_014702631.1.49734 XP_014702632.1.49734 XP_014955345.1.66739 XP_015151726.1.86415 XP_015151727.1.86415 XP_017913302.1.57651 XP_019827919.1.53367 XP_020747708.1.74333 ENSDNOP00000005420 ENSGALP00000001570 ENSBTAP00000015248 ENSMGAP00000018253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]