SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006231695.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006231695.1.100692
Domain Number 1 Region: 259-516
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.01e-78
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 135-242
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-32
Family Kringle modules 0.00042
Further Details:      
 
Domain Number 3 Region: 35-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000036
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 74-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006231695.1.100692
Sequence length 521
Comment PREDICTED: hyaluronan-binding protein 2 isoform X3 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSVVMLVFRVLLLIALVGNSAIGLSLMPFIAPPDPDPCQSNPCEHGGDCIIRGNTFSCSC
PAPFSGSRCQTVQNKCKDNPCVQGDCLITQTPPYYRCACKYPYTGPDCSKVLPVCRPNPC
QNGGVCSRHRRRSRFSCACPDQYKGRFCEIGPDDCYVGDGYSYRGKVSRTVNQNPCLYWN
SHLLLQENYNMFMEDAETHGIADHNFCRNPDGDHKPWCFVKVNSEKVKWEYCNVEVCPES
DAANPLGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTT
SMPQGHFCGGSLIHPCWVLTAAHCTDMSTKHLKVVLGDQDLKKTESHEQTFRVEKILKYS
QYNERDEIPHNDIALLKLKPVGGHCALESKYVKTVCLPSDPFPSGTECHISGWGVTETGE
GSRQLLDAKVKLIANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDG
TYYVYGIVSWGQECGKKPGVYTQVTKFLNWIKTTMHKEAGL
Download sequence
Identical sequences A2VD04
ENSRNOP00000022382 XP_006231695.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]