SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006233654.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006233654.1.100692
Domain Number 1 Region: 531-694
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-52
Family Sec7 domain 0.0000581
Further Details:      
 
Domain Number 2 Region: 730-866
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-25
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006233654.1.100692
Sequence length 1007
Comment PREDICTED: PH and SEC7 domain-containing protein 4 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MMGDHLRPMEFLNICLEDNLQPHPEAYPSEVHGHPGPSEPCQEHTWPFDPPESARPDAHH
GDSDVEPSHLGNRLVHGEASQAPASSRSLEDNSSLGSPQQNRSSSTQVVFWAGILQAQMC
VLDLEEELEKTEGLKAGLRCCIPPPSKDFLGDVGLKPSRPKEDEDSGDDSSGSEEENQTW
PKKKMPGSSPEWGAEEDSIFFDNPLFLESPCSDTSTEGECFSWGYPNSHLDMKTWPHRPQ
TLDSPLQEGTGLWTQENDLDLGSNTADHSRCSTPPFPVPSYKMHPCLALGSTEGAPIVPP
DQVGETSWEDDVGPGSPKAPSVDHELIQESDNFGSDLRPATTHPVQPWGSQIPQSLSDLA
PPLHEDLQDPSRPQKPLISQNGGERDAGCFQEPMLCTLAPWGSQASLLEPSCPESGGRGS
GPRPSPVSSQESSPQDQLHSLKWPQDTSHPSLLEKDKSELSSLKKDETEEVPSLMQEAEC
EDTSRSEDASVTEHHVHLASAEGLPESPMPPEEAQSPEEDWRPSPSREKMANSIRNDEGA
WNLALRLYQLNGFRKSEVAAHLRKNNDFSRAVAEAYLSFFQFEGQSLDRALRGFLQALVL
SGETQERERILYQFSKRFHYCNPGAFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEF
VTNLNGLQDGGNFPKELLKALYWSIRSEKLEWAVDEEDAARPEKDQPSPSAGKISSPFLQ
LAQDPTMPTYKQGILARKMHHDADGKKTPWGKRGWKMFHTLLRGMVLYFLKGEGQWLDGE
SLVGHMMDEPVGVHHSLASPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMASWIARINL
AAATHSAPPFPAAVGSQRRFVRPILPMGPAQSSLEEQHRSHENCLDAASDDLLDLQRNLP
ERRGRSRELEEYRLRKEYLEHEKTRYETYVQLLVARLHFPLKDLALWEDQLGNEADSCQE
PRPSLKKSHSSPSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL
Download sequence
Identical sequences D3ZPP3
ENSRNOP00000008161 NP_001128353.1.100692 NP_001128353.1.4139 XP_006233653.1.100692 XP_006233654.1.100692 10116.ENSRNOP00000008161 ENSRNOP00000008161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]