SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006237097.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006237097.1.100692
Domain Number 1 Region: 64-560
Classification Level Classification E-value
Superfamily Sema domain 5.49e-99
Family Sema domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1422-1547,1713-1869
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.63e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 992-1082
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000291
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 4 Region: 901-992
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000442
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 1079-1160
Classification Level Classification E-value
Superfamily E set domains 0.0000000000226
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 563-615
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000068
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006237097.1.100692
Sequence length 1937
Comment PREDICTED: plexin-D1 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MHSPRRAARARLDGSSAAGGAPPSARAAAAVPLPPRSHSRCPGLLPLPLLLLLGAARAGA
LEIQRRFPSPTPTNNFALDGTAGTVYLAAVNRLYQLSGANLSLEAEATVGPVPDSPLCHA
PQLPQASCEHPRRLTDNYNKILQLDPGQGLVVACGSIYQGLCQLRRRGNISALAVSFPPA
APTAEPVTVFPSMLNVAANHPNASTVGLVLPPASGTGGSRLLVGATYTGYGSAFFPRNRS
LEDHRFENTPEISIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHP
AVPPHSAHPYAYLALNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCA
GGAGRGDLYSRLVSVFPAREQFFAVFERPQGTPGARNAPAALCAFRFADVQAAIRAARTA
CFVEPAPDVVAVLDSVVQGTGPACESKRNIQLQPEQLDCGAAHLQHPLTILQPLRASPVF
RAPGLTAVAVANANNYTAVFLGTATGRLLKISLNESMQVVSRRVLTVAYGEPVHHVMQFD
PMDPGYLYLMTSHQMARVKVAACEVHSTCGDCVGAADAYCGWCTLETRCTFKQDCANSSL
PHFWTSASEGPSRCPAMTVLPSEIDVHRDYTGMILQISGSLPSLSGMEMACDYGNGVRTV
ARVPGPAYGHQIAYCNLLPRAQFPPFPAGQDHVTVEMSVRVKGHNIVSANFTIYDCSRIG
QVYPHTACTSCLSTQWPCSWCIQLHSCVSNQSRCQDSPNPTSPQDCPQIVPSPLAPVPTG
GSQDILVPLTKAAFFHGTSLQCSFGLEENFEAVWANDSLVRCNQVVLHTTQKSQVFPLSL
KLKGPPDRFLDSPNPMTVVVYNCAMGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLSG
TCPAPEIRAIEPLSGPLNGGTLLTIRGKNLGRRLSDVAHGVWIGNVACEPLADRYTVSEE
IVCATGPAPGAFSDVVTVNVSKEGRSREQFSYVLPRVHSLEPSMGPKAGGTRITIHGSDL
NVGSMLQVLVNDTDPCTDLTRTATSITCTVPRGTLPSPVPVCVRFESRGCVHGNLTFWYM
QNPVITAISPGRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTFCKVLNSTLIICPS
PGALSNASAPVDFFINGRAYADEAAEELLDPAEAQRGSRFRLDYLPNPQFSTAKREKWIK
HHPGEPLTLVIHKEQDSLGLESHEYHIKIGQVSCDIQIISDRVIHCSVNESLGTAEGQLP
ITIQVGNFNQTIATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTL
LQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYE
ERYVLPSKTLNSQGGSPPQETHPLLGEWNIPEHCRPSMEEGISLFSSLLNNKHFLIVFVH
ALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTES
VVEKMLTNWMSICMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLR
ENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDL
EWFASSTQSYVLRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDL
DTEKYFHLVLPTDELVEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSI
REDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKT
DHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPL
SEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQYKFE
QVVALMENNIYECYSEA
Download sequence
Identical sequences XP_006237097.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]