SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006245610.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006245610.1.100692
Domain Number 1 Region: 437-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.21e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000188
Further Details:      
 
Domain Number 2 Region: 579-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 1050-1125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000082
Further Details:      
 
Domain Number 4 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000083
Further Details:      
 
Domain Number 5 Region: 345-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000378
Further Details:      
 
Domain Number 6 Region: 147-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000132
Further Details:      
 
Domain Number 7 Region: 972-1048
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000109
Further Details:      
 
Domain Number 8 Region: 728-831
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 9 Region: 1120-1201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000679
Further Details:      
 
Domain Number 10 Region: 866-918,948-971
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 11 Region: 290-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 12 Region: 218-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  XP_006245610.1.100692
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0517
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006245610.1.100692
Sequence length 1268
Comment PREDICTED: vigilin isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEP
AGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVA
QEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSEIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKE
DAVREAQKELEALIQNLDNVVEDYMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQIT
RDYNVQIKFPDREENPVHSVEPSIQENGDEAGEGREAKETDPGSPRRCDIIVISGRKEKC
EAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSHTIAI
TGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHA
RIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
VVDSEALQVYMKPPAHEESKAPSKGFVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPK
TLPWGPKR
Download sequence
Identical sequences Q3KRF2
ENSRNOP00000049563 10116.ENSRNOP00000048476 ENSRNOP00000048476 NP_742036.2.100692 NP_742036.2.4139 XP_006245610.1.100692 XP_017452112.1.100692 XP_017452113.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]