SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006254268.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006254268.1.100692
Domain Number 1 Region: 154-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-53
Family DBL homology domain (DH-domain) 0.0000861
Further Details:      
 
Domain Number 2 Region: 384-500
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006254268.1.100692
Sequence length 595
Comment PREDICTED: neuroepithelial cell-transforming gene 1 protein isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MEPEPAAPKQPRPRRRSRRASVLSEDQAAGLPADTPGPAANERCSLRRGSSFTFLTPGPH
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLGRVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASTQKSFSRATVPTPTKRRSSALWSEMLDISMKESLTTREIKRQEAIY
ELSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARIGEAT
KPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHLDVQLLEKAILIIQEVLSDINLKKGES
ECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFGNSDKAKNIFRVRFQDPSPGQSHT
LQANDVFHKQQWFNCIRSAIAPFQRAASPLELQGLPDLHEECEENNPSAGNLRAQRRSCV
LPGVMQVDHESVLECGSSVQTSEDTRNAKAHRPQHGLRRARDKAQLGGKKKETLV
Download sequence
Identical sequences ENSRNOP00000023945 10116.ENSRNOP00000045161 XP_006254268.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]