SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006254870.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006254870.1.100692
Domain Number 1 Region: 11-226
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-47
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 256-446
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.42e-33
Family BAR domain 0.014
Further Details:      
 
Domain Number 3 Region: 592-673
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-20
Family SH3-domain 0.00049
Further Details:      
 
Domain Number 4 Region: 494-573
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006254870.1.100692
Sequence length 676
Comment PREDICTED: rho guanine nucleotide exchange factor 37 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MADFETDEASSKSESPEQEGQGSEDKSLLHQRLAIRELIDTEVSYLHTLRLCTSDIRGHL
QQLPPGDLDILFSNIDDIIQVSSRFLHGLQETACKEEKQAHLIGNLFLEFQEELEQVYKV
YCANYDQALLLVKAYQKEPELQKEIQGIIEAAVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTPADASAHPVLQRATSALQDVNSNINEYKMRKEVALKYTKVEQLSLRERLARINT
HTLSKKTTRLSQLLKQEAGLVPRTEDKEFDDLEERFQWVSLCVTELKSNVAAYMDNLEAF
LCFRPHERNLDIPGGAAEQYCSLARDLQLQAFLQFKQRLTGLVWQPLCSLARALVGPQNL
IKKRLDKLLDFERVEEKLLDVGSVTYEEEAARHTYQALNSLIVAELPQFNHLVMQWLGQI
LRTFVVLQRDLADQVLRRAESSMALLPHRHVSEPDFQKLLEDTLGQSSSQLRHFRESFEK
VLPPSTSQPLLPGSEHQMQSLLTRYGPGKIYQVTSNINGTGTLDLTLPRGQIVALLQNKD
TKGNNSRWLVDTGGHRGYVPAGKLQLYHPINPSEKEPRRQTGMPEDYWLPTPEPTQPSVP
TVPTMSQVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYVPSNF
LARTPSPTPWGWNLPS
Download sequence
Identical sequences F1LQ74
10116.ENSRNOP00000037964 XP_006254869.1.100692 XP_006254870.1.100692 XP_006254871.1.100692 XP_006254873.1.100692 ENSRNOP00000037964 ENSRNOP00000037964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]