SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006298520.1.15642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006298520.1.15642
Domain Number 1 Region: 31-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-66
Family Inorganic pyrophosphatase 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006298520.1.15642
Sequence length 218
Comment hypothetical protein CARUB_v10014598mg [Capsella rubella]; AA=GCF_000375325.1; RF=representative genome; TAX=81985; STAX=81985; NAME=Capsella rubella; cultivar=Monte Gargano; AL=Scaffold; RT=Major
Sequence
MADNKDEGSAKGYAFPLKNPNVTLNERNFAAFTHRQAAAHPWHDLEIGPEAPTVFNCVVE
ISKGGKVKYELDKNSGLIKVDRVLYSSIVYPHNYGFIPRTICEDSDPIDVLVLMQEPVLT
GSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYRELNELPPHRLAEIRRFFEDYKK
NENKKVDVEAFLPAQAAIDAIKDSMDLYAAYIKAGLQR
Download sequence
Identical sequences R0I4Z0
Carubv10014598m|PACid:20899495 XP_006298520.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]