SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006305610.1.15642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006305610.1.15642
Domain Number 1 Region: 28-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.2e-71
Family Inorganic pyrophosphatase 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006305610.1.15642
Sequence length 212
Comment hypothetical protein CARUB_v10010288mg [Capsella rubella]; AA=GCF_000375325.1; RF=representative genome; TAX=81985; STAX=81985; NAME=Capsella rubella; cultivar=Monte Gargano; AL=Scaffold; RT=Major
Sequence
MSEEANDDQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK
VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV
AVNDFLPSETAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences R0IN48
XP_006305610.1.15642 Carubv10010288m|PACid:20889917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]