SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006372731.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006372731.1.11743
Domain Number 1 Region: 376-392,548-654,709-807
Classification Level Classification E-value
Superfamily HAD-like 5.88e-36
Family Meta-cation ATPase, catalytic domain P 0.067
Further Details:      
 
Domain Number 2 Region: 9-106,254-375,801-1018
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.45e-35
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 3 Region: 388-573
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.05e-26
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0082
Further Details:      
 
Domain Number 4 Region: 102-173,212-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.02e-17
Family Calcium ATPase, transduction domain A 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006372731.1.11743
Sequence length 1107
Comment hypothetical protein POPTR_0017s04520g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MKRFVYINDDESSPTHDLYCDNRISNRKYTLLNFLPKNLMEQFSRFMNQYFLLIACLQLW
SLITPVNPASTWGPLIFIFAVSATKEAWDDYNRYLSDKKANEKQVWIVRKGIKKHIQAQD
ICVGNLVWLRENDEVPCDLVLIGTSDPQGLCYIETAALDGEIDLKTRVTPSACMGIDFEL
LHKIKGVIECPNPDKDIRRLDANLRLFPPFIDNDVCPLTIKNTILQSCYLRNTEWACGVA
VYTGNETKLGMSRGIPEPKLTALDAMIDKLTGAIFVFQIVVVMVLGIAGNVWKDTEARKL
WYVLYPDEGPWYELLVIPLRFELLCSIMIPISIKVSLDLVKSLYAKFIDWDREMIDLETE
TPSHATNTAISEDLGQVEYILTDKTGTLTENKMVFRICCISGNFYGNEAGDASKDKQLLN
AISSGSPDVVRFLTVMAICNTVIPVQSKTGAILYKAQSQDEDALVHAAAKLNMVLVCKNG
NILELRFNTSAIQYEVLETLEFTSDRKRMSVVVRDCQNGKILLLSKGADEAILPYASPGQ
QTRIFNEAVEQYSQLGLRTLCLAWRELKEDEYEEWSFMFREASSTLVDREWRIAEVCQRL
ERDLEVLGVTAIEDRLQDGVPETIYTLRKAGIHFWMLTGDKQNTAIQIALSCNFISPEPK
GQLLLIDGKTEEEVGRSLERVLLTMRTTASEPKDVAFVVDGWALEIALKHYWKAFTELAI
LSRTAICCRVTPSQKAQLVQILKSCDYRTLAIGDGGNDVRMIQQADIGVGISGREGLQAA
RAADYSIGRFRFLKRLILVHGRYSYNRTAFLSQYSFYKSLLICFIQIFFSFISGVSGTSL
FNSVSLMAYNVFYTSIPVLVSVLDKDLSEETVMQHPQILFYCQAGRLLNPSTFAGWFGRS
LFHAIVVFVISIHAYAFEKSEMEEVGMVALSGCIWLQAFVVTLETNSFTILQHLAIWGNL
IAFYVINWIVSAIPSSGMYTIMFRLCRQPSYWLTILLIVAAGMGPILAIKYFRYTYRPSK
INTLQQAERLGGPILSLGNIEPPQQRLIEKEVAPLSITQSKNRNPVYEPLLSDSPSTRRS
FGPGTPFDFFQSQSRLSSNYTRNCKDN
Download sequence
Identical sequences B9MYF4
POPTR_0017s04520.1|PACid:18210017 XP_006372731.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]