SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006397877.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006397877.1.70970
Domain Number 1 Region: 31-212
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-69
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006397877.1.70970
Sequence length 216
Comment hypothetical protein EUTSA_v10001628mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MSEETYEETQETSQSPRPVPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEIT
KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGC
FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNE
NKKVAVNDFLPSESAHEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences V4KN49
XP_006397877.1.70970 Thhalv10001628m|PACid:20189208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]