SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006409178.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006409178.1.70970
Domain Number 1 Region: 31-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.23e-68
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006409178.1.70970
Sequence length 218
Comment hypothetical protein EUTSA_v10022844mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MADNNNEGSAKSYASPLRNPNVTLNERNFAAFTHRSAAAHPWHDLEIGPEAPAVFNCVVE
ISKGGKVKYELDKNSGLIKVDRVLYSSIVYPHNYGFIPRTICEDSDPIDVLVLMQEPVLT
GSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDYKK
NENKKVAVEGFLPAQAAIDAIKDSMDLYAAYIKAGLQR
Download sequence
Identical sequences V4LJC5
XP_006409177.1.70970 XP_006409178.1.70970 Thhalv10022843m|PACid:20201892 Thhalv10022844m|PACid:20201891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]