SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006498111.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006498111.1.92730
Domain Number 1 Region: 465-792
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000263
Further Details:      
 
Domain Number 2 Region: 798-925
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.09e-18
Family Ricin B-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006498111.1.92730
Sequence length 930
Comment PREDICTED: polypeptide N-acetylgalactosaminyltransferase 5 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MNKIRKFFRGSGRVLAFIFAASVIWLLFDMAALRLSFSEINAGLLKEDIIRREHTGFRVE
PDQVKVLYTSIRGMGLPRNGAWGKENFRKAENHELKVEENMDQVQRKGKMQNLLGRRKAV
PLWHLAHLQTLPVTIPMQKTQGRDSKPEVSSQYMMSKWMTVLESEKTPFTASRGVPLTKI
AGRTETFDKKQEAPQNYNVSSDTSKQASERTLNMTISVKTDRSKQKSQTVTKLRMHFASP
PILKSEEVTVIKKAEAQSKDLKHEALKALPLLKFIADMGHLKNQSTNETQLGRLPEDDAA
KVAPGKKLNFSESHVVIITKEEELKTDTKEVPNSKTQTVFPKLLGGSPHKQIPRNQSKTS
SSPPALKKAVSQSKPTISGGLHTARSNLTAKAPTVGYQQSHANIPENPGMHHVFRIDVTL
SPRDLNAPGQFGRPVVVPPEKKKEAEQRWKEGNFNVYLSDLIPVDRAIEDTRPAGCAEQL
VHNDLPTTSIIMCFVDEVWSALLRSVHSVLNRSPPHLIKEILLVDDFSTKEYLKADLDKY
MSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEPLLERVYLNRK
KVACPVIEVINDKDMSYMTVDNFQRGVFTWPMNFGWKTIPPDVVAKNGIKETDIIRCPVM
AGGLFSIDKSYFYELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSRVGHIFRNDNP
YSFPKDRMKTVERNLVRVAEVWLDDYRELFYGHGDHLIDQGLDVGNLTQQRELRKKLKCK
SFKWYLDNVFPDLKAPVVRASGVLINMALGKCVSIENITVTLEDCDGSSQLQQFNYTWVR
LIKHGEWCVAPIPEKGSLTLYHCDNRNNRLKWLHKSASAFHPELVDHIVFENYQQLLCME
GNFSQKTLKLAACNPMELQQKWKFEKYYEV
Download sequence
Identical sequences Q8C102
ENSMUSP00000108235 ENSMUSP00000131362 NP_766443.2.92730 XP_006498111.1.92730 XP_006498112.1.92730 ENSMUSP00000108235 10090.ENSMUSP00000028171 ENSMUSP00000108235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]