SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006499332.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006499332.1.92730
Domain Number 1 Region: 203-345
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-33
Family Second domain of FERM 0.0000869
Further Details:      
 
Domain Number 3 Region: 18-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family First domain of FERM 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006499332.1.92730
Sequence length 570
Comment PREDICTED: FERM domain-containing protein 5 isoform X2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGI
RFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD
LYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHK
TELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHF
IKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGGELR
ALCQGHGGSEQEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDVAFFRDIRQTPE
FEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences A2AR56
ENSMUSP00000106222 ENSMUSP00000106222 XP_006499332.1.92730 ENSMUSP00000120176 10090.ENSMUSP00000106222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]