SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006504485.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006504485.1.92730
Domain Number 1 Region: 171-304
Classification Level Classification E-value
Superfamily PH domain-like 4.35e-40
Family Pleckstrin-homology domain (PH domain) 0.000000721
Further Details:      
 
Domain Number 2 Region: 406-512
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-23
Family SH2 domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 16-75
Classification Level Classification E-value
Superfamily Phenylalanine zipper 8.63e-22
Family Adapter protein APS, dimerisation domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006504485.1.92730
Sequence length 621
Comment PREDICTED: SH2B adapter protein 2 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHF
AANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARV
RKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAA
KVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRP
KVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDP
GDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVG
ESLAHVPLETFLQTLESSGGVSENNNPGDEGAELDTDAEAELELSDYPWFHGTLSRVKAA
QLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVF
DMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFS
SLATATCPPASPSNGAGASSSSGSSSSATSLPPRPAEGPLSAHSRSNSTEHLLDAASGAT
EEPTEATLGRARAVENQYSFY
Download sequence
Identical sequences Q9JID9
10090.ENSMUSP00000005188 ENSMUSP00000005188 NP_001289867.1.92730 NP_061295.2.92730 XP_006504483.2.92730 XP_006504485.1.92730 ENSMUSP00000005188 ENSMUSP00000005188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]