SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006513703.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006513703.1.92730
Domain Number 1 Region: 243-299
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 305-360
Classification Level Classification E-value
Superfamily SH3-domain 0.0000367
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006513703.1.92730
Sequence length 360
Comment PREDICTED: SH3 and cysteine-rich domain-containing protein 3 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTEKEVVESPQPPFPGETPQSGLQRLKQLFKKGSPETAEMEPPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCK
NCKTNIHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSDQQYAVSAANRNDPVFETLRVGV
IMANKERKKGQADKKNPLAAMMEEEPESARPEEGKSQDGNNAEKDKKAEKKTPDDKNKQP
GFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFIIRV
RAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI
Download sequence
Identical sequences Q8BZ71
NP_808375.1.92730 XP_006513703.1.92730 XP_006513705.1.92730 XP_021061110.1.100879 ENSMUSP00000048148 ENSMUSP00000048148 ENSMUSP00000125124 10090.ENSMUSP00000048148 ENSMUSP00000048148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]