SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006515143.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006515143.1.92730
Domain Number 1 Region: 187-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.68e-55
Family Voltage-gated potassium channels 0.0009
Further Details:      
 
Domain Number 2 Region: 15-128
Classification Level Classification E-value
Superfamily POZ domain 6.28e-33
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006515143.1.92730
Sequence length 491
Comment PREDICTED: potassium voltage-gated channel subfamily S member 3 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR
YQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDEHKSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDME
VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY
NTASLENCTGK
Download sequence
Identical sequences Q8BQZ8
NP_001162036.1.92730 NP_775593.1.92730 XP_006515143.1.92730 XP_011242164.1.92730 XP_011242165.1.92730 XP_011242166.1.92730 XP_011242167.1.92730 XP_011242168.1.92730 10090.ENSMUSP00000060706 ENSMUSP00000060706 ENSMUSP00000129412 ENSMUSP00000060706 ENSMUSP00000060706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]