SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006523451.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006523451.1.92730
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000269
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000241
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 96-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family EGF-type module 0.0057
Further Details:      
 
Weak hits

Sequence:  XP_006523451.1.92730
Domain Number - Region: 64-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00534
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006523451.1.92730
Sequence length 382
Comment PREDICTED: protein delta homolog 2 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPSGCRCLNLVCLLCILGATSQPARADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCL
PGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLM
RPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESG
LGESSLVALVVFGSLTAALVLATVLLTLRAWRRGICPTGPCCYPAPHYAPARQDQECQVS
MLPAGFPLSPDLPPEPGKTTAL
Download sequence
Identical sequences Q8K1E3
NP_001272942.1.92730 NP_001272957.1.92730 XP_006523451.1.92730 XP_006523452.1.92730 XP_011244537.1.92730 ENSMUSP00000126993 ENSMUSP00000128897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]