SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006525724.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006525724.1.92730
Domain Number 1 Region: 488-773
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-63
Family Nuclear receptor ligand-binding domain 0.0000000019
Further Details:      
 
Domain Number 2 Region: 434-517
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-25
Family Nuclear receptor 0.0000132
Further Details:      
 
Weak hits

Sequence:  XP_006525724.1.92730
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006525724.1.92730
Sequence length 793
Comment PREDICTED: glucocorticoid receptor isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQQQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDL
GYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSD
PSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDEN
LLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDF
IELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQ
QQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVS
SPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDC
IIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAA
LPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGF
RNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCK
HMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKR
EGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKY
SNGNIKKLLFHQK
Download sequence
Identical sequences E9PYV1
ENSMUSP00000095199 ENSMUSP00000095199 10090.ENSMUSP00000095199 ENSMUSP00000095199 XP_006525721.1.92730 XP_006525722.1.92730 XP_006525723.1.92730 XP_006525724.1.92730 XP_006525725.1.92730 XP_006525726.1.92730 XP_006525727.1.92730 XP_006525728.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]