SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006529329.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006529329.1.92730
Domain Number 1 Region: 54-376,406-518
Classification Level Classification E-value
Superfamily Ras GEF 9.15e-120
Family Ras GEF 0.0000611
Further Details:      
 
Domain Number 2 Region: 637-732
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-41
Family Ras-binding domain, RBD 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006529329.1.92730
Sequence length 766
Comment PREDICTED: ral guanine nucleotide dissociation stimulator-like 1 isoform X2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEGTSVGEPTQVVSKVKLSTKGENTGHWLVDDHARIWEVLKTEEVEGDQLPPGHTVSQYE
TCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTG
PNCEDDGSQSSPESKAVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLEYLKQMMPGS
DPERRAQNLLEQFQKQDVDSDNGLLNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTY
MDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTVLGSKELKT
QQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELS
DIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGT
FLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQR
QQLLSEEESYALSCEIEAAADANTTSPKPRKSMVKRLSLLFLGSDIIPGSTPTKEQPKSA
ASGSSGESMDSVSVSSCESNHSEAEEGPVTPMDTPDEPQKKLSESSSSCSSIHSMDTNSS
GMSSLINPLSSPPTCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNNGN
MYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAMNS
QVNFDFILRKKNSVEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
Download sequence
Identical sequences E9Q8N0
XP_006529329.1.92730 XP_017174875.1.92730 ENSMUSP00000107488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]