SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006531749.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006531749.1.92730
Domain Number 1 Region: 9-399
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-95
Family Ras GEF 0.0004
Further Details:      
 
Domain Number 2 Region: 495-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 410-489
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000902
Family Polcalcin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006531749.1.92730
Sequence length 608
Comment PREDICTED: RAS guanyl-releasing protein 2 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAERLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KERLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQSVE
DGVFDIHL
Download sequence
Identical sequences Q9QUG9
ENSMUSP00000041135 10090.ENSMUSP00000041135 ENSMUSP00000041135 ENSMUSP00000041135 ENSMUSP00000109104 ENSMUSP00000129873 NP_035372.2.92730 XP_006531748.1.92730 XP_006531749.1.92730 XP_006531750.1.92730 XP_006531751.1.92730 XP_006531752.1.92730 XP_006531753.1.92730 XP_006531754.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]