SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006533290.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006533290.1.92730
Domain Number 1 Region: 322-475
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-40
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Weak hits

Sequence:  XP_006533290.1.92730
Domain Number - Region: 277-324
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000615
Family DEK C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006533290.1.92730
Sequence length 1450
Comment PREDICTED: protein phosphatase Slingshot homolog 2 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MALVTVQRSPTPSTTSSPCASSSYLEDSESAALLCCEYGESEIFSDFNEADSGEEECRSQ
PRSISESFLTVKGAALFLPRGNGSSTPRVSHRRNKHAGDLQQHLQAMFILLRPEDNIRLA
VRLESTYQNRTRYMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLD
GDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARMHNYYPGSLFLTWVSYYESHI
NSDQSSVNEWNAMQDVQSHRPDSPALFTDIPTERERTERLIKTKLREIMMQKDLENITSK
EIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRG
VRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCK
MGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQGILLASKQRH
NKLWRSHSDSDLSDHHEPICKPGLELNKKEMTTSADQIAEVKTVENLAAMPTVFMEHVVP
QDANQKGLHTKERVICLEFSSQEFRAGQIEDELNLNDINGCSSGCCLSESKLPLDNCHAS
KALLQPGQAPDIANKFPDLAVEDLETDALKADMNVHLLPMEELTSRLKDLPMSPDLESPS
PQASCQAAISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRIEELGGGRSEGCRLSVIE
VAASEMAADDQRSSSLSNTPHASEESSVDEDQSKAITELVSPDIIMQSHSENAISVKEIV
TEIESISQGVGQVQLKGDILSNPCHTPKKSTIHELPLERVPAPESKPGHWEQDESFCSVQ
PELARDSGKCAPEEGCLTTHSSTADLEEEEPVEGEHDWGPGMHSGAKWCPGSVRRATLEF
EERLRQEQENHGTASAGPTLSNRKNSKNDSSVADLMPKWKSDETTPEHSFFLKEAEPSKG
KGKCSGSEAGSLSHCERNPTMPDCELLEHHSLPAPQDCLGSDSRSKKQEGDLKKQRAVVP
NQECDTQAILLPLPKKIEIIEYTPTVTSLGHTEPGGEATPSKEGEKQGLRKVKMEQSITM
FCALDENLNRTLEPSQVSLHPQVLPLPHSSSECDRPADPNPMLSSPQDKGDCPSTPFKTA
APFVSCSTQGASFSLDYLLPHSVVHLEGCTEQSSATDNELSPEQASWEDSRGHFLSSGSG
MAHTSSPLTNEDLSLINKLGDSVGVLQKKLDPSPEACRIPHSSSSENIRDLSHSRGVVKE
HAKEIESRVIFQAGFSKTSQMKRSASLAKLGYLDLCKDYLPDRELVSSESPHLKLLQPFL
RTDSGMHALMAHEPSESAGAQQNPQPTKYSVEQLKTSECIVQSKPVERPSVQYAKEFGYS
QQCLLPKARPELTSSEGGLPLLQTQGLQYTGPSPGLAVAPRQQHGRTHPLRRLKRANDKK
RTTNPFYNTM
Download sequence
Identical sequences ENSMUSP00000104034 10090.ENSMUSP00000104034 XP_006533290.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]