SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006533756.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006533756.1.92730
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-43
Family RUN domain 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006533756.1.92730
Sequence length 405
Comment PREDICTED: RUN domain-containing protein 3A isoform X9 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGSSEPN
Download sequence
Identical sequences ENSMUSP00000102719 XP_006533756.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]