SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006534165.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006534165.1.92730
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.97e-95
Family CAF1-like ribonuclease 0.00000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006534165.1.92730
Sequence length 292
Comment PREDICTED: CCR4-NOT transcription complex subunit 8 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDY
QYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSG
LQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHE
FFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFR
MKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAMINNMQQ
Download sequence
Identical sequences Q9D8X5
10090.ENSMUSP00000020822 ENSMUSP00000020822 354578 NP_081225.1.92730 XP_006534165.1.92730 XP_006534166.1.92730 XP_006534167.1.92730 XP_006534168.1.92730 XP_006534169.1.92730 ENSMUSP00000020822 ENSMUSP00000104471 ENSMUSP00000020822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]