SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006571671.1.77095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006571671.1.77095
Domain Number 1 Region: 55-506
Classification Level Classification E-value
Superfamily Sema domain 6.8e-135
Family Sema domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 1379-1507,1712-1900
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 863-960
Classification Level Classification E-value
Superfamily E set domains 3.18e-16
Family Other IPT/TIG domains 0.0091
Further Details:      
 
Domain Number 4 Region: 957-1045
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000121
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.024
Further Details:      
 
Domain Number 5 Region: 509-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000192
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1062-1144
Classification Level Classification E-value
Superfamily E set domains 0.00000000458
Family Other IPT/TIG domains 0.077
Further Details:      
 
Weak hits

Sequence:  XP_006571671.1.77095
Domain Number - Region: 821-853
Classification Level Classification E-value
Superfamily Plexin repeat 0.000209
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number - Region: 1174-1220
Classification Level Classification E-value
Superfamily E set domains 0.000644
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number - Region: 656-692
Classification Level Classification E-value
Superfamily Plexin repeat 0.00196
Family Plexin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006571671.1.77095
Sequence length 1932
Comment PREDICTED: plexin-A4 [Apis mellifera]; AA=GCF_000002195.4; RF=representative genome; TAX=7460; STAX=7460; NAME=Apis mellifera; strain=DH4; AL=Chromosome; RT=Major
Sequence
MAAFPGRRRSSGEGSARMGWWTVSHQQQLRLLLSFLVLLSPRLPVRSTPADIVQRFHDPE
VKRMNHLVVDKNTGRVYVGAVNRLYQLSPDLSVVVKEVTGPKGDSNACSMIDCPRETPTR
LVDNVNKALVIDYTTTRLISCGSLSQGTCRVRNLHNISDVVQEVKEAVVANNATASTVAF
IAPGPPNPPVSQVMYVGVTFTGNSPYRSEVPAVSSRSLDKDRMLNIAEAAVTTGTRMYVN
SLSRERYPINYVYGFSSGGFSYFMTTQMKNTDTAVFISKLVRVCHDDEHYYSYTEIPINC
TNDGTYYNLVQAAYVGKAGSVLAGDLGITAQDDVLFAVFSESNTTSSDIPKNHSALCVYS
LKAIRRKFMTNIQKCFSGEGHRGLEYISPSHKCILTKLQTIGEDFCGLDVNTPLGGEDPM
EGTPVLTFDTHLTAVAATSTGDYTVVFVGTNEGHLKKVVVESSSLALEYGDLEIDPGSPV
NPDLLFDSQLMHLYVMTQKTVSKVKVQECSVYKTCLDCLGAKDPYCGWCSLENKCNLRSD
CQDAAKDPLYWISYKSGRCTTITTVTPDQLQRTTARTLELVIENLPTLSGQFLCAFSTLD
KTLITNASRKSFGVNCTTPRTDLLPSIPQGQHHFTAKLSVRMTNGPDLVDTNFTFFDCNT
YSSCTKCVSSSFPCDWCVDGHRCTHDTAENCRNDILVTGISRTGPSYRSGPAFCPTLNAT
DSQEILVSSGVKKVIRVKVHIIGQFIVQTRFVCQFNIEGRVTIVNARLLADTIYCEETEF
SYTSRAPNITVPFAVIWGGSKPLDNPHNIHLVIYRCRDMADNCGMCLTLAPKYDCGWCQS
TDRCEVKDNCERNIGMWLNSNQTCPNPEIHSFEPVMGPWEGNTNVTIRGINLGQTFKDIY
RGVMVGGLRCQPYEELYMRTKQIVCRVDGPGTPEGKRGPVIVKIEDFRGTSEYNFEFVDP
QILSISPKYGPMSGGTTVRITGKYMNAGSTIKAFIDELSCSIISAEMNEALCMTSASDHK
RNGTVKMTFDGAFRIYSGTFEYADDPTIESVESGVAGQMKIPKGIPAGGIKISVTGKNLG
YIQSPQMYVYYDEKMFVSQCEVHSQESMICKSPTIEVPDNVVLDAEKPAMLEYGFRMDNV
TGVQNLSQHGFNHFLLYPNPIYEVFDEEIKYYKSDYLTINGQHLDRACQESDVTVQIGNA
FCNVTSLSRQQLTCRPPLTQPPAIDSDGFPNKQELPEVIVIVGGTLRYNIGKLSYALPAG
LNGPLSKPALFGVIAAIVILVVVFIAFLIAYRRKSTESNRVLKNMQEQMDILELRVAAEC
KEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMMILFPSDDNSPVLQWDRPELARKEKGL
RLFGQLIMNKTFLLLFVRTLESNRYFSMRDRVNVASLIMVTLQSKMEYCTDILKTLLAEL
IEKCTEGKSHPKLFLRRTESVAEKMLSAWFTFLLYKFMRECAGEPLYVLFRAVKQQVDKG
PVDAITSEARYSLSEEKLIRQSIDFKPMTVYVSISQQTVFVGGMDPNTENVPVKVLDCDT
ISQVKEKALDTIYRATPYSQRPRKDDLDLEWRTGASGRLILYDEDSTTKTEGEWKKRNTL
NHYRVPDGASLNLVSKQSSIYNLSILSEKTDKSHKYETLNLSKFSSASPPLSRATSPLNQ
NHDGGLKCWHLVKHHDSDARKEGDRGNKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTA
HRGSALPLAIKYMFDFMDDQALQHGISDPEVVHTWKSNSLPLRFWVNLIKNPNFIFDIHK
SNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPVYKEWVERYYADIKVMPA
ISDQDMNAMLAEESRLHTTEFNTNCALYELYTYAGKYNEQLIVTLEEDEFSQKQRLAYKL
EQVHNIMAADNP
Download sequence
Identical sequences XP_006571671.1.77095 XP_006571672.1.77095 XP_394261.3.77095 7460.XP_394261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]