SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006639695.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006639695.1.81211
Domain Number 1 Region: 111-204
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 197-296
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000749
Family PDZ domain 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006639695.1.81211
Sequence length 300
Comment PREDICTED: syntenin-1-like [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MSLYPSLEDLKVDKVMKAQASFAAKTSSPAITEGAPEEMPAGLGAPSSVLYPDLQELGEY
MGLRLNSDEVRNNMALVPAADNQVATAPSAMGGMVCPVTGGDVGVRRAEIKQGLREVILC
KDQDGKMGLRLRSIDNGVFIQLVQANSPAALAGLRFGDQVLQINGQNCAGWSQDTAHKML
KVAAEDRIELIVRDRPFQRTITMHKDSSGHVGFIFKNGKVTSIVKDSSAARNGLLTEHNI
CEINGQNVIGLKDPQIKDILTASSSAITITVMPKIIFEHMVKRMSAGLIKSVMDHSIPEV
Download sequence
Identical sequences W5MFT7
XP_006639695.1.81211 ENSLOCP00000007246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]