SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006640394.2.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006640394.2.81211
Domain Number 1 Region: 532-596,898-1017
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0061
Further Details:      
 
Domain Number 2 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-34
Family RUN domain 0.00074
Further Details:      
 
Domain Number 3 Region: 995-1116
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006640394.2.81211
Sequence length 1124
Comment PREDICTED: small G protein signaling modulator 1 isoform X3 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MATAMSEAETRQRLVRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRR
AAGFLRSNKIAALFMKVGKSFPLAEELCRKAQELEQIIENKRNQVPLNHESSRKLQKLPS
ISPQAVKHLWIRTALIEKVLDKIVLYLVENSSKYYEKEAVLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSAHCRQDSPTKRPALCIQKRHSSGSMDDRPSMS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAIPGYLSLHQTADIMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESVSDKEEDEATDYVFRI
LFPGSQSEFVPQDLMEQAPAMWHPTARKSSCSSCSQSASSDGGPLNGCNHERAPLKLLCD
NMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNHTIVDPDVPQDARGGLTAEIWQKYLQD
CTAYEEQELLRLVYFGGVEPSLRKEVWPFLLGHYQFGMSEKERKEVDDQVRACYEQTMSE
WLGCEAIVRQREKEQHAVALAKCSSGASLDSQIQKMMHRDSTVSNESSQSCSSDRHSHAQ
LQSDSSSSTQVFESVEEVEQIEMEPKGEEAKQATKVPNGVVPNGTCSPDSGHPSSRNFSI
TSGFSDRSLSTEDSAGAESTAKTSGQPQPPHPGSAKPAQQVVDPPGVKAPAQGPEEEPRE
QAAATAEDQGLEEALPPVTKARESASAEDSMVAKETSEELLSAIELPLGDDLGTGGVVGP
LVLEMQVDEEAEKQSLVGSEDALSEEPEMESLFPQFDSLAVGGEAKPDATSPVSSIGTTY
SQELLDMYTVNLHRIEKDVQRCDRNYWYFTPTNLEKLRNIMCSYIWQHLEIGYVQGMCDL
LAPLLVILDDEAMAFSCFTELMKRMNQNFPHGGVMDTHFANMRSLIQILDSELFELMHQN
GDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKYVSSSHFVLFIALALVELYRDII
LENNMDFTDIIKFFNEMAEHHNSKQVLKLARDLVYKVQTLIENK
Download sequence
Identical sequences W5M930
ENSLOCP00000004889 XP_006640394.2.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]