SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006640524.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006640524.1.81211
Domain Number 1 Region: 77-252
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-42
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 227-348
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006640524.1.81211
Sequence length 481
Comment PREDICTED: TBC1 domain family member 10A [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MAKTENGLRSSDPQNLRGTSESLAERESSSFGSDSEVNGFANTERQTDRYGFIGGAQQHT
GHSEQEVPPEVLRQREAKWLDMLNNWDKWMAKRHKKVKLRCQKGIPPSLRGRAWLYLSGG
KVKKEQNQRKFQELDSQPGDPKWLDVIEKDLHRQFPFHEMFVARGGHGQQDLFRVLKAYT
LYRPEEGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLDGEILFA
LLRRVSPAAHKHLKKHKIDPILYMTEWFMCAFSRTLPWASVLRVWDMFFCEGVKIIFRVG
LVLLKCMLGTQEKLKACQGQYETMELLRAVDPKYMLEGFLIREILELPVSERDIEKEHHV
QLKRWKETHGDLHYKSPPRMHGARAIITAEPHTRQDLRQNPTIVVEPPPPNAPPAKDEKK
KDKGRRGSLKKAPGSKKEVANPYPIPSVPPSLPADAPLQPEPESSQQDNQSLSSTELDTY
L
Download sequence
Identical sequences W5MNS2
XP_006640524.1.81211 ENSLOCP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]