SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006642204.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006642204.1.81211
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily RUN domain-like 4.45e-30
Family RUN domain 0.0012
Further Details:      
 
Domain Number 2 Region: 746-848
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006642204.1.81211
Sequence length 997
Comment PREDICTED: pleckstrin homology domain-containing family M member 2 isoform X1 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MDQLKVKDRILENISLSVKKLQSYFAACEEEAPAIRNHDRVLQRLCEHLDHALLYGLQDI
SSGYWVLVLHFTRREAVRQIEELQHIATNLGRSRAWLYLAMSESSLESYLRLFQENQGLL
QKYYFKNALVCSHDHLALFLTLVSGLEFIRFDLELDVPYLDVAPYMPDYYKPQNLLDFEE
RLPSSDSLSLHSFTSLTSTNLEWDDSAIAPSSEDYDFGEVFPVMQSMPSADWEEGDLTDP
ASCRSVACEPLVNRAATRSPTLRINPFNEDSDTNPSTDTTPVHSARCEAFEDDAESTGTD
LEVIRLAKRRKPGRKRQGKGRLSSASTSHLPVGHRPPEHEGRGSGGPVAGAGGPQDGPLG
SGQDGARAEEGQEGEEEEGEDEGEGLLRLPEMTDTSMESVGQPLREVMEQLEGTLDCKTW
EPRAGAQPPPQQPFRSDSEGEPPDPPPASSLSLAQEPHALQASPPRDFYRFTPESPGPAA
TGGGHDDPAGPGQPAHVHGGHEAEGAGEAPTGKTLGLLGERGEEEGRAMPLQNGSALTPE
LPLSGREEEEQPPSPSETSHAAEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGN
LQPLYLLLTDCYIYLLRKGAAEKPYTVEEAVSYNELDYISVGMDQQTVTLVCTNRRRQFL
LDTADKSLTEWFLASLKSAMIKGCREPPYPSVLTDATMEKLALTKFVVQESHCEASEVCI
KLYSLVHWEDPLDTSGDHDAGLHNHPDSSVVKEGPLLYRAGTSYLGKEVWKSCYLVLSNG
ILFQYPERTDVTPLLSINMGGQQCGGCRRSNTTEQLHSFQVILTERPPLELSAENEQDMA
DWMLYLCQSVSKGVVPQDAAPTPCIPCCLVLTDRKMFVCHEDCQTSFFRSLGSAELADVR
AVRVESDREYCVIEFAEDKKQFLPPWVLYFSCSVERDRVLGALETTWKEIFQVVLPRQEV
LDPAVQQKCGDALSLIRSAWQRSDSLRRGRSEREPWC
Download sequence
Identical sequences W5MN17
ENSLOCP00000009776 XP_006642204.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]