SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006642231.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006642231.1.81211
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 2.38e-34
Family Sedlin (SEDL) 0.0036
Further Details:      
 
Weak hits

Sequence:  XP_006642231.1.81211
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000599
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006642231.1.81211
Sequence length 219
Comment PREDICTED: trafficking protein particle complex subunit 4 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MAIFSVYVVNKAGGLIYQYDNYVPRAEAEKTFSYPLDLVLKTHDERVIVSFGQRDGIRVG
HAVLSVNGVDVNGRYTADGKEIIEYLKDPSSYPVSIRFGKPRLSSNEKLMLASMFHSLFA
IGSQLSPEVGSSGIEMLETDTFKLHCFQTLTGIKFIVLADPRQSGIDALLRKIYEIYSDY
ALKNPFYSLEMPIRCELFDQNLKSALEVAEKTGTFGPGS
Download sequence
Identical sequences W5M665
XP_006642231.1.81211 ENSLOCP00000003873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]