SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006735525.1.47382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006735525.1.47382
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 1.73e-23
Family Caspase recruitment domain, CARD 0.0000111
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 7.53e-19
Family DEATH domain, DD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006735525.1.47382
Sequence length 199
Comment PREDICTED: death domain-containing protein CRADD [Leptonychotes weddellii]; AA=GCF_000349705.1; RF=representative genome; TAX=9713; STAX=9713; NAME=Leptonychotes weddellii; AL=Scaffold; RT=Major
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGVLTENHVQEIKAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREESITELPADDQMTGIPLHILNSSPSDQQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQMVEAFIRWRQRYGKQATFRSL
HRGLQAVEADPSVLQHMLE
Download sequence
Identical sequences XP_006735525.1.47382 XP_021543200.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]